PDB entry 1x2k

View 1x2k on RCSB PDB site
Description: Solution Structure of the SH3 Domain of Human osteoclast stimulating factor 1 (OSTF1)
Class: signaling protein
Keywords: SH3 domain, Human osteoclast stimulating factor 1, OSTF1, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-04-25, released 2005-10-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Osteoclast stimulating factor 1
  Species: Homo sapiens [TaxId:9606]
  Gene: OSTF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92882 (7-61)
    • cloning artifact (0-6)
    • cloning artifact (62-67)
  Domains in SCOPe 2.06: d1x2ka1, d1x2ka2, d1x2ka3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x2kA (A:)
  gssgssgkvfralytfeprtpdelyfeegdiiyitdmsdtnwwkgtskgrtglipsnyva
  eqsgpssg