PDB entry 1x2j

View 1x2j on RCSB PDB site
Description: Structural basis for the defects of human lung cancer somatic mutations in the repression activity of Keap1 on Nrf2
Class: transcription
Keywords: beta propeller, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-04-25, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2ja1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x2jA (A:)
    tlhkptqavpcrapkvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagc
    vvggllyavggrnnspdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyav
    ggshgcihhssveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsae
    cyypernewrmitpmntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfva
    pmrhhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvav
    tmepcrkqidqqnctc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2jA (A:)
    vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
    pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
    eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
    ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
    gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc