PDB entry 1x2i

View 1x2i on RCSB PDB site
Description: Crystal Structure Of Archaeal Xpf/Mus81 Homolog, Hef From Pyrococcus Furiosus, Helix-hairpin-helix Domain
Class: hydrolase
Keywords: alpha helix, helix-hairpin-helix DNA binding domain, homodimer, HYDROLASE
Deposited on 2005-04-24, released 2005-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.222
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hef helicase/nuclease
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF2015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2ia1
  • Chain 'B':
    Compound: Hef helicase/nuclease
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF2015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x2iA (A:)
    mekkaltlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiak
    eirrvitapyiedee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2iA (A:)
    altlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiakeirr
    vitapyie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x2iB (B:)
    mekkaltlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiak
    eirrvitapyiedee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2iB (B:)
    altlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiakeirr
    vitapyie