PDB entry 1x2g

View 1x2g on RCSB PDB site
Description: Crystal Structure of Lipate-Protein Ligase A from Escherichia coli
Class: ligase
Keywords: lipoate-protein ligase, lipoic acid, protein acylation, post-translational modification
Deposited on 2005-04-23, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2ga1, d1x2ga2
  • Chain 'B':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2gb1, d1x2gb2
  • Chain 'C':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2gc1, d1x2gc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x2gA (A:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2gA (A:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgrvtn
    ltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfg
    qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
    lqqeceallvdfpeqekelrelsawmagavr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x2gB (B:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2gB (B:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakrvtnl
    tellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfgq
    apafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradml
    qqeceallvdfpeqekelrelsawmagavr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2gC (C:)
    stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
    rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
    wewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgc
    lyradmlqqeceallvdfpeqekelrelsawmagavr