PDB entry 1x2e

View 1x2e on RCSB PDB site
Description: The crystal structure of prolyl aminopeptidase complexed with Ala-TBODA
Class: Hydrolase
Keywords: prolyl aminopeptidase, prolyl iminopeptidase, binary complex, alpha/beta-hydrolase fold
Deposited on 2005-04-22, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.177
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2ea_
  • Heterogens: ATX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x2eA (A:)
    meqlrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfd
    perykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlal
    ayaqthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaa
    yrqrltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlg
    flesddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsyde
    pgilhqlmiatdrfagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2eA (A:)
    lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
    ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
    qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
    rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
    sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
    lhqlmiatdrfag