PDB entry 1x2b

View 1x2b on RCSB PDB site
Description: The crystal structure of prolyl aminopeptidase complexed with Sar-TBODA
Class: hydrolase
Keywords: prolyl aminopeptidase, binary complex, prolyl iminopeptidase, alpha/beta-hydrolase
Deposited on 2005-04-22, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x2ba_
  • Heterogens: STX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x2bA (A:)
    meqlrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfd
    perykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlal
    ayaqthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaa
    yrqrltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlg
    flesddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsyde
    pgilhqlmiatdrfagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x2bA (A:)
    lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
    ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
    qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
    rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
    sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
    lhqlmiatdrfag