PDB entry 1x27

View 1x27 on RCSB PDB site
Description: Crystal Structure of Lck SH2-SH3 with SH2 binding site of p130Cas
Class: signaling protein
Keywords: Lck-Cas complex, LCK phospho-peptide complex, High affinity LCK-Cas complex, SIGNALING PROTEIN
Deposited on 2005-04-20, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.247
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x27a1, d1x27a2
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (4-166)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1x27b1, d1x27b2, d1x27b3
  • Chain 'C':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (4-166)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1x27c1, d1x27c2, d1x27c3
  • Chain 'D':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x27d1, d1x27d2
  • Chain 'E':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x27e1, d1x27e2
  • Chain 'F':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x27f1, d1x27f2
  • Chain 'I':
    Compound: CRK-associated substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63767
      • modified residue (3)
  • Chain 'J':
    Compound: CRK-associated substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63767
      • modified residue (3)
  • Chain 'K':
    Compound: CRK-associated substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63767
      • modified residue (3)
  • Chain 'L':
    Compound: CRK-associated substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63767
      • modified residue (3)
  • Chain 'M':
    Compound: CRK-associated substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63767
      • modified residue (3)
  • Chain 'N':
    Compound: CRK-associated substrate
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63767
      • modified residue (3)
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x27A (A:)
    gshmnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvaka
    nslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvk
    hykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x27A (A:)
    nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansle
    pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
    rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x27B (B:)
    gshmnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvaka
    nslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvk
    hykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x27B (B:)
    mnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansl
    epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x27C (C:)
    gshmnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvaka
    nslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvk
    hykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x27C (C:)
    mnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansl
    epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x27D (D:)
    gshmnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvaka
    nslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvk
    hykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x27D (D:)
    nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansle
    pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
    rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1x27E (E:)
    gshmnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvaka
    nslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvk
    hykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x27E (E:)
    nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansle
    pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
    rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1x27F (F:)
    gshmnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvaka
    nslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvk
    hykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x27F (F:)
    nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansle
    pepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyki
    rnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.