PDB entry 1x25

View 1x25 on RCSB PDB site
Description: Crystal Structure of a Member of YjgF Family from Sulfolobus Tokodaii (ST0811)
Class: structural genomics, unknown function
Keywords: YJGF-LIKE PROTEIN, ARCHAEA, ST0811, structural genomics, UNKNOWN FUNCTION
Deposited on 2005-04-20, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.148
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0076 protein ST0811
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST0811
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q973T6 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1x25a1, d1x25a2
  • Chain 'B':
    Compound: Hypothetical UPF0076 protein ST0811
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST0811
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q973T6 (3-127)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1x25b2, d1x25b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x25A (A:)
    gshmetvftekapkpvgpysqaikvgntlyvsgqipidprtneivkgdikvqtrqvldni
    keivkaagfslsdvamafvflkdmnmfndfnsvyaeyfkdkpparvtvevsrlpkdalie
    iavicskg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x25A (A:)
    shmetvftekapkpvgpysqaikvgntlyvsgqipidprtneivkgdikvqtrqvldnik
    eivkaagfslsdvamafvflkdmnmfndfnsvyaeyfkdkpparvtvevsrlpkdaliei
    avicsk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x25B (B:)
    gshmetvftekapkpvgpysqaikvgntlyvsgqipidprtneivkgdikvqtrqvldni
    keivkaagfslsdvamafvflkdmnmfndfnsvyaeyfkdkpparvtvevsrlpkdalie
    iavicskg