PDB entry 1x24

View 1x24 on RCSB PDB site
Description: Prl-1 (ptp4a)
Deposited on 2005-04-20, released 2005-10-11
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.241
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase 4a1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: protein tyrosine phosphatase 4a1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1x24A (A:)
    mgsshhhhhhssglvprgshmarmnrpapvevtyknmrflithnptnatlnkfieelkky
    gvttivrvceatydttlvekegihvldwpfddgappsnqivddwlslvkikfreepgcci
    avhcvaglgrapvlvalalieggmkyedavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records):
    >1x24A (A:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
    avqfirqkrrgafnskqllylekyrpkmrlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1x24B (B:)
    mgsshhhhhhssglvprgshmarmnrpapvevtyknmrflithnptnatlnkfieelkky
    gvttivrvceatydttlvekegihvldwpfddgappsnqivddwlslvkikfreepgcci
    avhcvaglgrapvlvalalieggmkyedavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records):
    >1x24B (B:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
    avqfirqkrrgafnskqllylekyrpkmrlrf