PDB entry 1x23

View 1x23 on RCSB PDB site
Description: Crystal structure of ubch5c
Class: ligase
Keywords: Ubiquitin conjugating enzyme, Ubiquitin, E2, LIGASE
Deposited on 2005-04-19, released 2005-05-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.204
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (8-154)
      • cloning artifact (2-7)
    Domains in SCOPe 2.03: d1x23a1
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (8-154)
      • cloning artifact (3-7)
    Domains in SCOPe 2.03: d1x23b_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (8-154)
      • cloning artifact (3-7)
    Domains in SCOPe 2.03: d1x23c_
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (8-154)
      • cloning artifact (1-7)
    Domains in SCOPe 2.03: d1x23d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x23A (A:)
    gplgspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffl
    tihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcd
    pnpddplvpeiariyktdrdkynrisrewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x23A (A:)
    lgspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvfflti
    hfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpn
    pddplvpeiariyktdrdkynrisrewtqkyam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x23B (B:)
    gplgspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffl
    tihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcd
    pnpddplvpeiariyktdrdkynrisrewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x23B (B:)
    gspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
    fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
    ddplvpeiariyktdrdkynrisrewtqkyam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x23C (C:)
    gplgspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffl
    tihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcd
    pnpddplvpeiariyktdrdkynrisrewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x23C (C:)
    gspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
    fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
    ddplvpeiariyktdrdkynrisrewtqkyam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x23D (D:)
    gplgspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffl
    tihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcd
    pnpddplvpeiariyktdrdkynrisrewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x23D (D:)
    plgspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvfflt
    ihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdp
    npddplvpeiariyktdrdkynrisrewtqkyam