PDB entry 1x1v

View 1x1v on RCSB PDB site
Description: Structure Of Banana Lectin- Methyl-Alpha-Mannose Complex
Class: sugar binding protein
Keywords: all beta sheet protein, beta prism-I fold, mannose specific, SUGAR BINDING PROTEIN
Deposited on 2005-04-14, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Musa acuminata [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1va_
  • Chain 'B':
    Compound: lectin
    Species: Musa acuminata [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1vb_
  • Heterogens: MMA, ZN, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1vA (A:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsgg
    tpheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagk
    isgffgrggdfidaigvylep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1vA (A:)
    aikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggtph
    eivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagkisg
    ffgrggdfidaigvylep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x1vB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsgg
    tpheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagk
    isgffgrggdfidaigvylep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1vB (B:)
    ngaikvgawggnggsafdmgpayriisvkifsgdvvdavdvtftyygktetrhfggsggt
    pheivlqegeylvgmkgefgnyhgvvvvgklgfstnkksygpfgntggtpfslpiaagki
    sgffgrggdfidaigvylep