PDB entry 1x1t

View 1x1t on RCSB PDB site
Description: Crystal Structure of D-3-Hydroxybutyrate Dehydrogenase from Pseudomonas fragi Complexed with NAD+
Class: oxidoreductase
Keywords: NAD, NADH, SDR, short chain dehydrogenase, ketone body, beta-hydroxybutyrate, OXIDOREDUCTASE
Deposited on 2005-04-13, released 2006-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.195
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi [TaxId:296]
    Database cross-references and differences (RAF-indexed):
    • GB BAD86668 (0-259)
    Domains in SCOPe 2.07: d1x1ta_
  • Heterogens: MG, CAC, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1tA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1tA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtllsekqpslqfvtpeqlggtavflasdaaaqitgttvsvdggwtar