PDB entry 1x1p

View 1x1p on RCSB PDB site
Description: Crystal structure of Tk-RNase HII(1-197)-A(28-42)
Class: hydrolase
Keywords: ribonuclease HII, amyloid peptide, Thermococcus kodakaraensis, HYDROLASE
Deposited on 2005-04-11, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.245
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hii
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74035 (0-196)
      • cloning artifact (197-211)
    Domains in SCOPe 2.07: d1x1pa1, d1x1pa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x1pA (A:)
    mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
    ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
    rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
    enyyrehgefppivrkgagaiiglavggvvia