PDB entry 1x1m

View 1x1m on RCSB PDB site
Description: Solution Structure of the N-terminal Ubiquitin-like Domain in Mouse Ubiquitin-like Protein SB132
Class: structural genomics, unknown function
Keywords: SB132, ubiquitin-like protein, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-04-07, released 2005-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SB132
    Species: Mus musculus [TaxId:10090]
    Gene: Sb132
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91W67 (7-100)
      • cloning artifact (0-6)
      • cloning artifact (101-106)
    Domains in SCOPe 2.08: d1x1ma1, d1x1ma2, d1x1ma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x1mA (A:)
    gssgssgmslsdwhlavkladqplapksilqlpetelgeyslggysisflkqliagklqe
    svpdpelidliycgrklkddqtldfygiqpgstvhvlrkswsgpssg