PDB entry 1x1l

View 1x1l on RCSB PDB site
Description: Interaction of ERA,a GTPase protein, with the 3'minor domain of the 16S rRNA within the THERMUS THERMOPHILUS 30S subunit.
Class: structural protein/RNA
Keywords: Interaction of Era protein with the 3'minor domain of 16S rRNA
Deposited on 2005-04-06, released 2005-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (130-mer)
    Species: Thermus thermophilus
  • Chain 'X':
    Compound: GTP-binding protein era
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x1lx1, d1x1lx2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1x1lX (X:)
    msidksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiy
    vdtpglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvi
    lavnkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhf
    pedyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilvere
    gqkkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslgyvdd
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1lX (X:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl