PDB entry 1x1l

View 1x1l on RCSB PDB site
Description: Interaction of ERA,a GTPase protein, with the 3'minor domain of the 16S rRNA within the THERMUS THERMOPHILUS 30S subunit.
Class: structural protein/RNA
Keywords: Interaction of Era protein with the 3'minor domain of 16S rRNA, STRUCTURAL PROTEIN/RNA COMPLEX
Deposited on 2005-04-06, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 13.5 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (130-mer)
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'X':
    Compound: GTP-binding protein era
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1lx1, d1x1lx2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1x1lX (X:)
    msidksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiy
    vdtpglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvi
    lavnkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhf
    pedyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilvere
    gqkkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslgyvdd
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1lX (X:)
    dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
    pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
    nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfped
    yitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregqk
    kmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl