PDB entry 1x1g

View 1x1g on RCSB PDB site
Description: Solution structure of the C-terminal PH domain of human pleckstrin 2
Class: signaling protein
Keywords: Pleckstrin 2, PH domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2005-04-04, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin 2
    Species: HOMO SAPIENS
    Gene: PLEK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NYT0 (7-122)
      • cloning artifact (0-6)
      • cloning artifact (123-128)
    Domains in SCOP 1.73: d1x1ga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x1gA (A:)
    gssgssgslstvelsgtvvkqgylakqghkrknwkvrrfvlrkdpaflhyydpskeenrp
    vggfslrgslvsaledngvptgvkgnvqgnlfkvitkddthyyiqasskaeraewieaik
    kltsgpssg