PDB entry 1x1g

View 1x1g on RCSB PDB site
Description: Solution structure of the C-terminal PH domain of human pleckstrin 2
Class: signaling protein
Keywords: Pleckstrin 2, PH domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, SIGNALING PROTEIN
Deposited on 2005-04-04, released 2005-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pleckstrin 2
  Species: Homo sapiens [TaxId:9606]
  Gene: PLEK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NYT0 (7-122)
    • cloning artifact (0-6)
    • cloning artifact (123-128)
  Domains in SCOPe 2.08: d1x1ga1, d1x1ga2, d1x1ga3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x1gA (A:)
  gssgssgslstvelsgtvvkqgylakqghkrknwkvrrfvlrkdpaflhyydpskeenrp
  vggfslrgslvsaledngvptgvkgnvqgnlfkvitkddthyyiqasskaeraewieaik
  kltsgpssg