PDB entry 1x1f

View 1x1f on RCSB PDB site
Description: Solution structure of the PH domain of human Docking protein BRDG1
Class: signaling protein
Keywords: Docking protein BRDG1, PH domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-04-04, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Signal-transducing adaptor protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: brdg1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ULZ2 (7-142)
    • cloning artifact (0-6)
    • cloning artifact (143-148)
  Domains in SCOPe 2.07: d1x1fa1, d1x1fa2, d1x1fa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x1fA (A:)
  gssgssgqerlkitalplyfegfllikrsgyreyehywtelrgttlffytdkksiiyvdk
  ldivdltclteqnstekncakftlvlpkeevqlktentesgeewrgfiltvtelsvpqnv
  sllpgqviklhevlerekkrriesgpssg