PDB entry 1x1f

View 1x1f on RCSB PDB site
Description: Solution structure of the PH domain of human Docking protein BRDG1
Class: signaling protein
Keywords: Docking protein BRDG1, PH domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-04-04, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Signal-transducing adaptor protein 1
  Species: HOMO SAPIENS
  Gene: brdg1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ULZ2 (7-142)
    • cloning artifact (0-6)
    • cloning artifact (143-148)
  Domains in SCOP 1.73: d1x1fa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x1fA (A:)
  gssgssgqerlkitalplyfegfllikrsgyreyehywtelrgttlffytdkksiiyvdk
  ldivdltclteqnstekncakftlvlpkeevqlktentesgeewrgfiltvtelsvpqnv
  sllpgqviklhevlerekkrriesgpssg