PDB entry 1x14

View 1x14 on RCSB PDB site
Description: Crystal structure of E. coli transhydrogenase domain I with bound NAD
Deposited on 2005-03-31, released 2005-09-13
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(p) transhydrogenase subunit alpha
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: pntA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07001 (8-End)
      • expression tag (6-7)
  • Chain 'B':
    Compound: nad(p) transhydrogenase subunit alpha
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: pntA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07001 (8-End)
      • expression tag (4-7)
  • Heterogens: NAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1x14A (A:)
    mhhhhhhgrigiprerltnetrvaatpktveqllklgftvavesgagqlasfddkafvqa
    gaeivegnsvwqseiilkvnaplddeiallnpgttlvsfiwpaqnpelmqklaernvtvm
    amdsvprisraqsldalssmaniagyraiveaahefgrfftgqitaagkvppakvmviga
    gvaglaaigaanslgaivrafdtrpevkeqvqsmgaefleldfkeeagsgdgyakvmsda
    fikaemelfaaqakevdiivttalipgkpapklitremvdsmkagsvivdlaaqnggnce
    ytvpgeifttengvkvigytdlpgrlptqssqlygtnlvnllkllckekdgnitvdfddv
    virgvtvirageitwpappiqvsaqpqaaqkaapevkteek
    

    Sequence, based on observed residues (ATOM records):
    >1x14A (A:)
    hgrigiprerltnetrvaatpktveqllklgftvavesgagqlasfddkafvqagaeive
    gnsvwqseiilkvnaplddeiallnpgttlvsfiwpaqnpelmqklaernvtvmamdsvp
    risraqsldalssmaniagyraiveaahefgrfftgqitaagkvppakvmvigagvagla
    aigaanslgaivrafdtrpevkeqvqsmgaefleldfdgyakvmsdafikaemelfaaqa
    kevdiivttalipgkpapklitremvdsmkagsvivdlaaqnggnceytvpgeiftteng
    vkvigytdlpgrlptqssqlygtnlvnllkllckekdgnitvdfddvvirgvtviragei
    twpapp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1x14B (B:)
    mhhhhhhgrigiprerltnetrvaatpktveqllklgftvavesgagqlasfddkafvqa
    gaeivegnsvwqseiilkvnaplddeiallnpgttlvsfiwpaqnpelmqklaernvtvm
    amdsvprisraqsldalssmaniagyraiveaahefgrfftgqitaagkvppakvmviga
    gvaglaaigaanslgaivrafdtrpevkeqvqsmgaefleldfkeeagsgdgyakvmsda
    fikaemelfaaqakevdiivttalipgkpapklitremvdsmkagsvivdlaaqnggnce
    ytvpgeifttengvkvigytdlpgrlptqssqlygtnlvnllkllckekdgnitvdfddv
    virgvtvirageitwpappiqvsaqpqaaqkaapevkteek
    

    Sequence, based on observed residues (ATOM records):
    >1x14B (B:)
    hhhgrigiprerltnetrvaatpktveqllklgftvavesgagqlasfddkafvqagaei
    vegnsvwqseiilkvnaplddeiallnpgttlvsfiwpaqnpelmqklaernvtvmamds
    vprisraqsldalssmaniagyraiveaahefgrfftgqitaagkvppakvmvigagvag
    laaigaanslgaivrafdtrpevkeqvqsmgaefleldmsdafikaemelfaaqakevdi
    ivttalipgkpapklitremvdsmkagsvivdlaaqnggnceytvpgeifttengvkvig
    ytdlpgrlptqssqlygtnlvnllkllckekdgnitvdfddvvirgvtvirageitwpap
    piqv