PDB entry 1x12

View 1x12 on RCSB PDB site
Description: Structure of Mutant Pyrrolidone Carboxyl Peptidase (E192D) from a Hyperthermophile, Pyrococcus furiosus
Class: hydrolase
Keywords: Stability of Protein, hydrolase
Deposited on 2005-03-31, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73944 (0-207)
      • engineered (141)
      • engineered (187)
      • engineered (191)
    Domains in SCOPe 2.07: d1x12a_
  • Chain 'B':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73944 (0-207)
      • engineered (141)
      • engineered (187)
      • engineered (191)
    Domains in SCOPe 2.07: d1x12b_
  • Chain 'C':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73944 (0-207)
      • engineered (141)
      • engineered (187)
      • engineered (191)
    Domains in SCOPe 2.07: d1x12c_
  • Chain 'D':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73944 (0-207)
      • engineered (141)
      • engineered (187)
      • engineered (191)
    Domains in SCOPe 2.07: d1x12d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x12A (A:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemdleavkvaievaleell
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x12B (B:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemdleavkvaievaleell
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x12C (C:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemdleavkvaievaleell
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x12D (D:)
    mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
    pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
    mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
    gqvppsmsyemdleavkvaievaleell