PDB entry 1x11

View 1x11 on RCSB PDB site
Description: x11 ptb domain
Class: complex (peptide binding module/peptide)
Keywords: complex (peptide binding module/peptide), ptb domain
Deposited on 1997-07-28, released 1998-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: x11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02410 (1-End)
      • modified residue (31-32)
      • modified residue (43)
      • modified residue (62)
      • modified residue (85-86)
      • modified residue (106)
      • modified residue (135)
    Domains in SCOPe 2.08: d1x11a_
  • Chain 'B':
    Compound: x11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02410 (Start-171)
      • modified residue (31-32)
      • modified residue (43)
      • modified residue (62)
      • modified residue (85-86)
      • modified residue (106)
      • modified residue (135)
    Domains in SCOPe 2.08: d1x11b_
  • Chain 'C':
    Compound: 13-mer peptide
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 13-mer peptide
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x11A (A:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapeges
    qpmtevdlfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqen
    veashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x11A (A:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqmtevdlfiltqrik
    vlnadtqetmmdhplrtisyiadignivvlmardgkrqykmichvfesedaqliaqsigq
    afsvayqeflrangi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x11B (B:)
    medlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapeges
    qpmtevdlfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqen
    veashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x11B (B:)
    iifaanylgstqllvrmmqaqeavsrikmaqklaksmtevdlfiltqrikvlnadtqetm
    mdhplrtisyiadignivvlmarykmichvfesedaqliaqsigqafsvayqeflrangi
    np
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.