PDB entry 1x0x

View 1x0x on RCSB PDB site
Description: Co-Structure of Homo Sapiens Glycerol-3-Phosphate Dehydrogenase 1 complex with NAD
Class: oxidoreductase
Keywords: NAD, co-enzyme, GPD1, OXIDOREDUCTASE
Deposited on 2005-03-31, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21695 (5-353)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1x0xa1, d1x0xa2, d1x0xa3
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x0xA (A:)
    gplgsmaskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiin
    tqhenvkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatg
    islikgvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgq
    llkelmqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmem
    iafaklfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngq
    klqgpetarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0xA (A:)
    smaskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhe
    nvkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgisli
    kgvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllke
    lmqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafa
    klfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqg
    petarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm