PDB entry 1x0v

View 1x0v on RCSB PDB site
Description: Crystal Structure of Homo Sapien Glycerol-3-Phosphate Dehydrogenase 1
Class: Oxidoreductase
Keywords: two independent domains, GXGXXG motif, Oxidoreductase
Deposited on 2005-03-30, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21695 (Start-353)
      • modified residue (42)
      • modified residue (148)
      • modified residue (152)
      • modified residue (185)
      • modified residue (237)
      • modified residue (239)
      • modified residue (327)
      • modified residue (353)
    Domains in SCOPe 2.07: d1x0va1, d1x0va2
  • Chain 'B':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21695 (5-353)
      • modified residue (5)
      • modified residue (42)
      • modified residue (148)
      • modified residue (152)
      • modified residue (185)
      • modified residue (237)
      • modified residue (239)
      • modified residue (327)
      • modified residue (353)
    Domains in SCOPe 2.07: d1x0vb1, d1x0vb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x0vA (A:)
    gplgsmaskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiin
    tqhenvkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatg
    islikgvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgq
    llkelmqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmem
    iafaklfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngq
    klqgpetarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0vA (A:)
    askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
    kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikg
    vdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelm
    qtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafakl
    fcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpe
    tarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x0vB (B:)
    gplgsmaskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiin
    tqhenvkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatg
    islikgvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgq
    llkelmqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmem
    iafaklfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngq
    klqgpetarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0vB (B:)
    maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
    vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
    gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
    mqtpnfritvvqevdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafak
    lfcsgpvssatflescgvadlittcyggrnrkvaeafartgksieqlekellngqklqgp
    etarelysilqhkglvdkfplfmavykvcyegqpvgefihclqnhpehm