PDB entry 1x0u

View 1x0u on RCSB PDB site
Description: Crystal Structure of the carboxyl transferase subunit of putative PCC of Sulfolobus tokodaii
Class: lyase
Keywords: lyase
Deposited on 2005-03-29, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical methylmalonyl-CoA decarboxylase alpha subunit
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x0ua1, d1x0ua2
  • Chain 'B':
    Compound: hypothetical methylmalonyl-CoA decarboxylase alpha subunit
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x0ub1, d1x0ub2
  • Chain 'C':
    Compound: hypothetical methylmalonyl-CoA decarboxylase alpha subunit
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x0uc1, d1x0uc2
  • Chain 'D':
    Compound: hypothetical methylmalonyl-CoA decarboxylase alpha subunit
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x0ud1, d1x0ud2
  • Chain 'E':
    Compound: hypothetical methylmalonyl-CoA decarboxylase alpha subunit
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x0ue1, d1x0ue2
  • Chain 'F':
    Compound: hypothetical methylmalonyl-CoA decarboxylase alpha subunit
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x0uf1, d1x0uf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x0uA (A:)
    amyekppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimt
    fattratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivraye
    lalkvgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavy
    spaltdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseq
    eainltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivd
    ngeflevhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafn
    iplislvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsik
    slgadlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaa
    ekglvddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0uA (A:)
    kppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimtfatt
    ratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivrayelalk
    vgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavyspal
    tdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseqeain
    ltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngef
    levhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafnipli
    slvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslga
    dlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekgl
    vddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x0uB (B:)
    amyekppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimt
    fattratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivraye
    lalkvgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavy
    spaltdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseq
    eainltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivd
    ngeflevhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafn
    iplislvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsik
    slgadlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaa
    ekglvddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0uB (B:)
    kppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimtfatt
    ratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivrayelalk
    vgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavyspal
    tdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseqeain
    ltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngef
    levhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafnipli
    slvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslga
    dlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekgl
    vddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x0uC (C:)
    amyekppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimt
    fattratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivraye
    lalkvgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavy
    spaltdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseq
    eainltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivd
    ngeflevhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafn
    iplislvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsik
    slgadlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaa
    ekglvddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0uC (C:)
    kppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimtfatt
    ratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivrayelalk
    vgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavyspal
    tdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseqeain
    ltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngef
    levhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafnipli
    slvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslga
    dlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekgl
    vddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x0uD (D:)
    amyekppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimt
    fattratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivraye
    lalkvgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavy
    spaltdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseq
    eainltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivd
    ngeflevhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafn
    iplislvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsik
    slgadlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaa
    ekglvddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0uD (D:)
    kppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimtfatt
    ratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivrayelalk
    vgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavyspal
    tdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseqeain
    ltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngef
    levhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafnipli
    slvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslga
    dlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekgl
    vddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1x0uE (E:)
    amyekppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimt
    fattratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivraye
    lalkvgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavy
    spaltdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseq
    eainltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivd
    ngeflevhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafn
    iplislvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsik
    slgadlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaa
    ekglvddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0uE (E:)
    kppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimtfatt
    ratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivrayelalk
    vgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavyspal
    tdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseqeain
    ltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngef
    levhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafnipli
    slvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslga
    dlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekgl
    vddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1x0uF (F:)
    amyekppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimt
    fattratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivraye
    lalkvgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavy
    spaltdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseq
    eainltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivd
    ngeflevhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafn
    iplislvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsik
    slgadlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaa
    ekglvddviepkdtrrvivaglemlktkreyrypkkhgnipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0uF (F:)
    kppveklieelrqlkekaykgggderiqfqhskgkltarerlallfddgkfneimtfatt
    ratefgldkqrfygdgvvtgwgkvdgrtvfayaqdftvlggslgethankivrayelalk
    vgapvvgindsggariqegalslegygavfkmnvmasgvipqitimagpaaggavyspal
    tdfiimikgdayymfvtgpeitkvvlgeevsfqdlggavvhatksgvvhfmvdseqeain
    ltkrllsylpsnnmeeppyidtgdpadrdatgveqivpndaakpynmreiiykivdngef
    levhkhwaqniivgfariagnvvgivannpeefggsididaadkaarfirfcdafnipli
    slvdtpgyvpgtdqeykgiirhgakmlyafaeatvpkitvivrksyggahiamsikslga
    dlvyawptaeiavtgpegavrilyrkeiqqasnpddvlkqriaeyrklfanpywaaekgl
    vddviepkdtrrvivaglemlktkreyrypkkhgnipl