PDB entry 1x0t

View 1x0t on RCSB PDB site
Description: Crystal structure of ribonuclease P protein Ph1601p from Pyrococcus horikoshii OT3
Deposited on 2005-03-29, released 2005-11-15
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.217
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component 4
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1x0tA (A:)
    mvdivkrrdwekkekkkiaieridtlftlaervaryspdlakryvelaleiqkkakvkip
    rkwkrryckrchtflipgvnarvrlrtkrmphvvitclecgyimrypylrevkqkrkkat
    

    Sequence, based on observed residues (ATOM records):
    >1x0tA (A:)
    ivkrrdwekkekkkiaieridtlftlaervaryspdlakryvelaleiqkkakvkiprkw
    krryckrchtflipgvnarvrlrtkrmphvvitclecgyimrypyl