PDB entry 1x0p

View 1x0p on RCSB PDB site
Description: Structure of a cyanobacterial BLUF protein, Tll0078
Class: electron transport
Keywords: BLUF, Tll0078, FAD, STRUCTURAL GENOMICS
Deposited on 2005-03-27, released 2005-06-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pa1
  • Chain 'B':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pb1
  • Chain 'C':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pc1
  • Chain 'D':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pd1
  • Chain 'E':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pe1
  • Chain 'F':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pf1
  • Chain 'G':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pg1
  • Chain 'H':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0ph1
  • Chain 'I':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pi1
  • Chain 'J':
    Compound: hypothetical protein Tll0078
    Species: Thermosynechococcus elongatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x0pj1
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x0pA (A:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pA (A:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydmsqgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x0pB (B:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pB (B:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydms
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x0pC (C:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pC (C:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydms
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x0pD (D:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pD (D:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydms
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1x0pE (E:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pE (E:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydmsqg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1x0pF (F:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pF (F:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydmsqgs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1x0pG (G:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pG (G:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydms
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1x0pH (H:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pH (H:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydm
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1x0pI (I:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pI (I:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydmsqg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1x0pJ (J:)
    mglhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvs
    etyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfq
    prsmtaeqcfrflkelydmsqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0pJ (J:)
    glhrliylscatdglsypdlrdimaksevnnlrdgitgmlcygngmflqtlegdrqkvse
    tyarilkdprhhsaeivefkaieertfinwsmrlvqlgemdsdtirrlrlkyspaatfqp
    rsmtaeqcfrflkelydms