PDB entry 1x0n

View 1x0n on RCSB PDB site
Description: NMR structure of growth factor receptor binding protein SH2 domain complexed with the inhibitor
Class: peptide binding protein
Keywords: peptide binding protein
Deposited on 2005-03-24, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x0na_
  • Heterogens: DTF

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x0nA (A:)
    gshpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0nA (A:)
    wffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagkyf
    lwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpt