PDB entry 1x0l

View 1x0l on RCSB PDB site
Description: Crystal structure of tetrameric homoisocitrate dehydrogenase from an extreme thermophile, Thermus thermophilus
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, DECARBOXYLATING DEHYDROGENASE, Lysine biosynthesis
Deposited on 2005-03-24, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.216
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homoisocitrate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Gene: hicdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x0la_
  • Chain 'B':
    Compound: Homoisocitrate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Gene: hicdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x0lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x0lA (A:)
    ayricliegdgighevipaarrvleatglplefveaeagwetferrgtsvpeetvekils
    chatlfgaatsptrkvpgffgairylrrrldlyanvrpaksrpvpgsrpgvdlvivrent
    eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
    fldtvkevakdfplvnvqdiivdncamqlvmrperfdvivttnllgdilsdlaaglvggl
    glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
    dlvlergprtpdlggdatteafteavvealksl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x0lB (B:)
    ayricliegdgighevipaarrvleatglplefveaeagwetferrgtsvpeetvekils
    chatlfgaatsptrkvpgffgairylrrrldlyanvrpaksrpvpgsrpgvdlvivrent
    eglyveqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqgl
    fldtvkevakdfplvnvqdiivdncamqlvmrperfdvivttnllgdilsdlaaglvggl
    glapsgnigdttavfepvhgsapdiagkgianptaailsaammldylgekeaakrvekav
    dlvlergprtpdlggdatteafteavvealksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x0lB (B:)
    ayricliegdgighevipaarrvleatglplefveaeagwetferrgtsvpeetvekils
    chatlfgaatvpgffgairylrrrldlyanvrpaksrpvpgsrpgvdlvivrenteglyv
    eqerryldvaiadaviskkaserigraalriaegrprktlhiahkanvlpltqglfldtv
    kevakdfplvnvqdiivdncamqlvmrperfdvivttnllgdilsdlaaglvgglglaps
    gnigdttavfepvhgsaiagkgianptaailsaammldylgekeaakrvekavdlvlerg
    prtpdlggdatteafteavvealksl