PDB entry 1x0h

View 1x0h on RCSB PDB site
Description: Solution structure of the carboxyl-terminal RGC domain in human IQGAP1
Class: signaling protein
Keywords: cell adhesion, beta-sandwich, protein-protein interaction, structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, National Project on Protein Structural and Functional Analyses, SIGNALING PROTEIN, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2005-03-23, released 2005-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating-like protein IQGAP1
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA ha00940
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46940 (7-105)
      • cloning artifact (0-6)
      • cloning artifact (106-111)
    Domains in SCOPe 2.07: d1x0ha1, d1x0ha2, d1x0ha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x0hA (A:)
    gssgssgislkytaarlhekgvlleiedlqvnqfknvifeispteevgdfevkakfmgvq
    metfmlhyqdllqlqyegvavmklfdrakvnvnllifllnkkfygksgpssg