PDB entry 1x0a

View 1x0a on RCSB PDB site
Description: Crystal Structure of type II malate/lactate dehydrogenase from thermus thermophilus HB8
Class: oxidoreductase
Keywords: malate dehydrogenase, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2005-03-16, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate/L-lactate dehydrogenase family protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x0aa_
  • Heterogens: NA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x0aA (A:)
    mrwradflsawaeallrkagadepsakavawalveadlrgvgshgllrlpvyvrrleagl
    vnpsptlpleergpvalldgehgfgprvalkaveaaqslarrhglgavgvrrsthfgmag
    lyaeklaregfvawvttnaepdvvpfggrekalgtnplafaapapqgilvadlatsesam
    gkvflarekgerippswgvdregsptddphrvyalrplggpkgyalallvevlsgvltga
    gvahgigrmydewdrpqdvghfllaldpgrfvgkeaflermgalwqalkatppapgheev
    flpgelearrreralaegmalpervvaelkalgerygvpwrdda