PDB entry 1x09

View 1x09 on RCSB PDB site
Description: Crystal structure of the D26A mutant UPPs in complex with magnesium and isopentenyl pyrophosphate
Class: transferase
Keywords: enzyme substrate complex, TRANSFERASE
Deposited on 2005-03-15, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Undecaprenyl pyrophosphate synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60472
      • engineered (25)
    Domains in SCOPe 2.07: d1x09a_
  • Heterogens: MG, IPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x09A (A:)
    mmlsatqplseklpahgcrhvaiimagngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x09A (A:)
    lseklpahgcrhvaiimagngrwakkqgkirafghkagaksvrravsfaanngiealtly
    afssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirkse
    altagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelap
    vdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr