PDB entry 1x06

View 1x06 on RCSB PDB site
Description: Crystal structure of undecaprenyl pyrophosphate synthase in complex with Mg, IPP and Fspp
Class: transferase
Keywords: enzyme-substrate complex, metal coordination, TRANSFERASE
Deposited on 2005-03-15, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Undecaprenyl pyrophosphate synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x06a_
  • Heterogens: PO4, MG, FPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x06A (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x06A (A:)
    klpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafs
    senwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealt
    agntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdl
    virtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre