PDB entry 1x05

View 1x05 on RCSB PDB site
Description: Solution structure of the C-terminal PH domain of human pleckstrin
Class: signaling protein
Keywords: pleckstrin, PH domain, structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, National Project on Protein Structural and Functional Analyses, SIGNALING PROTEIN, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2005-03-15, released 2005-09-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pleckstrin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08567 (7-122)
    • cloning artifact (0-6)
    • cloning artifact (123-128)
  Domains in SCOPe 2.05: d1x05a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x05A (A:)
  gssgssgvilkeefrgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedpl
  gaihlrgcvvtsvesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr
  tgksgpssg