PDB entry 1x04

View 1x04 on RCSB PDB site
Description: Crystal structure of endophilin BAR domain (mutant)
Class: transferase
Keywords: BAR domain, TRANSFERASE
Deposited on 2005-03-14, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3-containing grb2-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99962 (71-229)
      • modified residue (40)
      • modified residue (52)
      • modified residue (55)
      • linker (63-70)
      • modified residue (79)
      • modified residue (103)
      • modified residue (183)
      • modified residue (189)
    Domains in SCOPe 2.07: d1x04a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x04A (A:)
    gplgsmsvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtkti
    eylahlssllqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkq
    nfidplqnlhdkdlreiqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeia
    essmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x04A (A:)
    gtkldddfkemerkvdvtsravmeimtktieylahlssllqaeallaeamlkfgrelgdd
    cnfgpalgevgeamrelsevkdsldievkqnfidplqnlhdkdlreiqhhlkklegrrld
    fdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhk
    qavqilqqvtvrleerirqa