PDB entry 1x03

View 1x03 on RCSB PDB site
Description: Crystal structure of endophilin BAR domain
Class: transferase
Keywords: BAR domain, TRANSFERASE
Deposited on 2005-03-14, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.236
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3-containing grb2-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99962 (Start-251)
      • modified residue (40)
      • modified residue (52)
      • modified residue (55)
      • modified residue (74)
      • modified residue (101)
      • modified residue (125)
      • modified residue (205)
      • modified residue (211)
    Domains in SCOPe 2.07: d1x03a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x03A (A:)
    gplgsmsvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtkti
    eylqpnpasraklsmintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalg
    evgeamrelsevkdsldievkqnfidplqnlhdkdlreiqhhlkklegrrldfdykkkrq
    gkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqq
    vtvrleerirqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x03A (A:)
    gtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmipgypqaeallaeam
    lkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnlhdkdlreiqhh
    lkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsa
    lvqaqleyhkqavqilqqvtvrleerirqa