PDB entry 1wzz

View 1wzz on RCSB PDB site
Description: Structure of endo-beta-1,4-glucanase CMCax from Acetobacter xylinum
Class: hydrolase
Keywords: Glycoside Hydrolase family 8 (GH-8), (ALPHA/ALPHA)6 BARREL, Structural Genomics, STRUCTURAL GENOMICS CONSORTIUM for Research on Gene Expression System, SGCGES
Deposited on 2005-03-10, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.176
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable endoglucanase
    Species: Gluconacetobacter xylinus [TaxId:28448]
    Gene: cmcAX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37696
      • modified residue (54)
      • modified residue (69)
      • modified residue (71)
      • modified residue (131)
      • modified residue (141)
      • modified residue (143)
      • modified residue (152)
      • modified residue (173)
      • modified residue (192)
      • modified residue (249)
    Domains in SCOPe 2.07: d1wzza1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wzzA (A:)
    mrgshhhhhhgsdpapdavaqqwaifrakylrpsgrvvdtgnggeshsegqgygmlfaas
    agdlasfqsmwmwartnlqhtndklfswrflkghqppvpdknnatdgdllialalgragk
    rfqrpdyiqdamaiygdvlnlmtmkagpyvvlmpgavgftkkdsvilnlsyyvmpsllqa
    fdltadprwrqvmedgirlvsagrfgqwrlppdwlavnratgalsiasgwpprfsydair
    vplyfywahmlapnvladftrfwnnfganalpgwvdlttgarspynappgylavaectgl
    dsagelptldhapdyysaaltllvyiaraeetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzzA (A:)
    apdavaqqwaifrakylrpsgrvvdtgnggeshsegqgygmlfaasagdlasfqsmwmwa
    rtnlqhtndklfswrflkghqppvpdknnatdgdllialalgragkrfqrpdyiqdamai
    ygdvlnlmtmkagpyvvlmpgavgftkkdsvilnlsyyvmpsllqafdltadprwrqvme
    dgirlvsagrfgqwrlppdwlavnratgalsiasgwpprfsydairvplyfywahmlapn
    vladftrfwnnfganalpgwvdlttgarspynappgylavaectgldsagelptldhapd
    yysaaltllvyiaraeeti