PDB entry 1wzy

View 1wzy on RCSB PDB site
Description: Crystal structure of human ERK2 complexed with a pyrazolopyridazine derivative
Class: transferase
Keywords: ERK2, inhibitor, kinase, TRANSFERASE
Deposited on 2005-03-10, released 2005-12-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.253
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1wzya_
  • Heterogens: F29, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wzyA (A:)
    gdlgsdelmaaaaaagagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrva
    ikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdl
    ykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglar
    vadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkh
    yldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldk
    mltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeeta
    rfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzyA (A:)
    gagpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqr
    tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
    yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
    vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
    sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
    lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg