PDB entry 1wzv

View 1wzv on RCSB PDB site
Description: Crystal Structure of UbcH8
Class: ligase
Keywords: ubiquitin, ubiquitin conjugating enzyme, e2, ligase
Deposited on 2005-03-10, released 2005-03-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 L6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wzva1
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 L6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wzvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wzvA (A:)
    gshmasmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfp
    peypfkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnir
    eplrmdladlltqnpelfrknaeeftlrfgvdrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzvA (A:)
    asmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfppeyp
    fkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnireplr
    mdladlltqnpelfrknaeeftlrfgvdrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wzvB (B:)
    gshmasmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfp
    peypfkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnir
    eplrmdladlltqnpelfrknaeeftlrfgvdrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzvB (B:)
    asmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfppeyp
    fkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnireplr
    mdladlltqnpelfrknaeeftlrfgvdrp