PDB entry 1wzu

View 1wzu on RCSB PDB site
Description: Crystal structure of quinolinate synthase (nadA)
Class: biosynthetic protein
Keywords: nad, biosynthetic protein
Deposited on 2005-03-09, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinolinate synthetase A
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wzua1
  • Heterogens: MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wzuA (A:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakaya
    dvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftldd
    verakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrk
    lypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzuA (A:)
    mdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdf
    maetakilnpdkvvlipsvehileakrkypnapvvlyvnstaeakayadvtvtsanavev
    vkkldsdvvifgpdknlahyvakmtgkkiipvftlddverakklhpnaklmihpecipev
    qekadiiastggmikracewdewvvfteremvyrlrklypqkkfyparedafcaitlkni
    yeslkdmkykvevpeeiarkarkaiermlem