PDB entry 1wzo

View 1wzo on RCSB PDB site
Description: Crystal Structure of the HpcE from Thermus Thermophilus HB8
Deposited on 2005-03-08, released 2006-02-21
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HpcE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144224 (0-245)
  • Chain 'B':
    Compound: HpcE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144224 (0-245)
  • Chain 'C':
    Compound: HpcE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144224 (0-End)
  • Chain 'D':
    Compound: HpcE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144224 (0-245)
  • Heterogens: NA, SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wzoA (A:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyadhaeel
    glsrpeepalfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyv
    lgytiandlvardyvtntfrppirakgrdtflplgpflvveevedpqdlwlrayvngelr
    qeghtsrmlysvaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalen
    pieeep
    

    Sequence, based on observed residues (ATOM records):
    >1wzoA (A:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyaglsrpe
    epalfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyvlgytia
    ndlvardyvrppirakgrdtflplgpflvveevedpqdlwlrayvngelrqeghtsrmly
    svaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalenpieeep
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wzoB (B:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyadhaeel
    glsrpeepalfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyv
    lgytiandlvardyvtntfrppirakgrdtflplgpflvveevedpqdlwlrayvngelr
    qeghtsrmlysvaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalen
    pieeep
    

    Sequence, based on observed residues (ATOM records):
    >1wzoB (B:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyasrpeep
    alfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyvlgytiand
    lvardyvtntfrppirakgrdtflplgpflvveevedpqdlwlrayvngelrqeghtsrm
    lysvaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalenpieeep
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1wzoC (C:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyadhaeel
    glsrpeepalfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyv
    lgytiandlvardyvtntfrppirakgrdtflplgpflvveevedpqdlwlrayvngelr
    qeghtsrmlysvaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalen
    pieeep
    

    Sequence, based on observed residues (ATOM records):
    >1wzoC (C:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyarpeepa
    lfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyvlgytiandl
    vardyvtntfrppirakgrdtflplgpflvveevedpqdlwlrayvngelrqeghtsrml
    ysvaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalenpieee
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1wzoD (D:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyadhaeel
    glsrpeepalfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyv
    lgytiandlvardyvtntfrppirakgrdtflplgpflvveevedpqdlwlrayvngelr
    qeghtsrmlysvaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalen
    pieeep
    

    Sequence, based on observed residues (ATOM records):
    >1wzoD (D:)
    mklarflakgrvhqgvyregllldeageahrpedvtwllpftpgkilgvalnyasrpeep
    alfwkpntsllphkgvvlypkgarfvhyevelavvvgrpmkrvrakdaldyvlgytiand
    lvardyvtntfrppirakgrdtflplgpflvveevedpqdlwlrayvngelrqeghtsrm
    lysvaellefisefmtlepydvlltgtpkgisqvrpgdvmrleieglgalenpieeep