PDB entry 1wzn

View 1wzn on RCSB PDB site
Description: Crystal Structure of the SAM-dependent methyltransferase from Pyrococcus horikoshii OT3
Class: Transferase
Keywords: SAM-dependent methyltransferase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2005-03-08, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAM-dependent methyltransferase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA30409 (0-End)
    Domains in SCOPe 2.07: d1wzna1
  • Chain 'B':
    Compound: SAM-dependent methyltransferase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA30409 (0-End)
    Domains in SCOPe 2.07: d1wznb_
  • Chain 'C':
    Compound: SAM-dependent methyltransferase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA30409 (0-End)
    Domains in SCOPe 2.07: d1wznc_
  • Heterogens: SO4, MG, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wznA (A:)
    myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
    ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
    eedlrklfskvaealkpggvfitdfpcwfyggrdgpvvwneqkgeeklvimdwrevepav
    qklrfkrlvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspnd
    mrywivgiaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wznA (A:)
    myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
    ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
    eedlrklfskvaealkpggvfitdfpcgpvvwneqkgeeklvimdwrevepavqklrfkr
    lvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspndmrywivg
    iaks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wznB (B:)
    myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
    ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
    eedlrklfskvaealkpggvfitdfpcwfyggrdgpvvwneqkgeeklvimdwrevepav
    qklrfkrlvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspnd
    mrywivgiaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wznB (B:)
    myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
    ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
    eedlrklfskvaealkpggvfitdfpcgpvvwneqkgeeklvimdwrevepavqklrfkr
    lvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspndmrywivg
    iaks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wznC (C:)
    myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
    ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
    eedlrklfskvaealkpggvfitdfpcwfyggrdgpvvwneqkgeeklvimdwrevepav
    qklrfkrlvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspnd
    mrywivgiaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wznC (C:)
    myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
    ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
    eedlrklfskvaealkpggvfitdfpcgpvvwneqkgeeklvimdwrevepavqklrfkr
    lvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspndmrywivg
    iaks