PDB entry 1wzg

View 1wzg on RCSB PDB site
Description: Crystal Structure Of An Artificial Metalloprotein: Fe(Salophen)/Wild Type Heme oxygenase
Class: oxidoreductase
Keywords: Electron-Transfer, Artificial Metalloprotein, Heme oxygenase, salophen, OXIDOREDUCTASE
Deposited on 2005-03-04, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119 (Start-214)
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • see remark 999 (191)
    Domains in SCOPe 2.07: d1wzga_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119 (Start-214)
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • see remark 999 (191)
    Domains in SCOPe 2.07: d1wzgb_
  • Heterogens: SO4, YOM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wzgA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzgA (A:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgkgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wzgB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzgB (B:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgkgl