PDB entry 1wzc

View 1wzc on RCSB PDB site
Description: Crystal structure of Pyrococcus horikoshii mannosyl-3-phosphoglycerate phosphatase complexed with MG2+ and phosphate
Class: Hydrolase
Keywords: haloacid dehalogenase like hydrolase, phosphatase
Deposited on 2005-03-04, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-01-27, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannosyl-3-phosphoglycerate phosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0926
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58690 (0-242)
      • engineered (217)
      • expression tag (243)
    Domains in SCOPe 2.07: d1wzca1, d1wzca2
  • Chain 'B':
    Compound: Mannosyl-3-phosphoglycerate phosphatase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0926
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58690 (0-242)
      • engineered (217)
      • expression tag (243)
    Domains in SCOPe 2.07: d1wzcb2, d1wzcb3
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wzcA (A:)
    mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
    isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
    eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
    gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
    vikhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzcA (A:)
    mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
    isengsaifipkgyfpyivielgirvekireelkkleniyglkyygnstkeeiekftgmp
    pelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdkgkaakilldf
    ykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvlevikh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wzcB (B:)
    mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
    isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
    eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
    gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
    vikhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wzcB (B:)
    mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
    isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
    eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
    gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
    vikh