PDB entry 1wza

View 1wza on RCSB PDB site
Description: Crystal structure of alpha-amylase from H.orenii
Class: hydrolase
Keywords: halothermothrix orenii, hydrolase, alpha amylase, halophilic, thermophilic
Deposited on 2005-03-03, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.186
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase A
    Species: Halothermothrix orenii [TaxId:31909]
    Gene: AMYA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wzaa1, d1wzaa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wzaA (A:)
    fekhgtyyeifvrsfydsdgdgigdlkgiiekldylndgdpetiadlgvngiwlmpifks
    psyhgydvtdyykinpdygtledfhklveaahqrgikviidlpinhtserhpwflkasrd
    knseyrdyyvwagpdtdtketkldggrvwhysptgmyygyfwsgmpdlnynnpevqekvi
    giakywlkqgvdgfrldgamhifppaqydknftwwekfrqeieevkpvylvgevwdiset
    vapyfkygfdstfnfklaeaviatakagfpfgfnkkakhiygvydrevgfgnyidapflt
    nhdqnrildqlgqdrnkarvaasiyltlpgnpfiyygeeigmrgqgphevirepfqwyng
    sgegetywepamyndgftsveqeeknldsllnhyrrlihfrnenpvfytgkieiinggln
    vvafrryndkrdlyvyhnlvnrpvkikvasgnwtllfnsgdkeitpvednnklmytipay
    ttivleke