PDB entry 1wz9

View 1wz9 on RCSB PDB site
Description: The 2.1 A structure of a tumour suppressing serpin
Class: signaling protein
Keywords: maspin, serpin, tumor suppressor, serpinb5, signaling protein
Deposited on 2005-03-03, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maspin precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36952 (0-374)
      • modified residue (19)
      • see remark 999 (65)
      • modified residue (182)
      • modified residue (204)
      • modified residue (213)
      • modified residue (322)
      • modified residue (372)
    Domains in SCOPe 2.07: d1wz9a_
  • Chain 'B':
    Compound: Maspin precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINB5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36952 (0-374)
      • modified residue (19)
      • see remark 999 (65)
      • modified residue (182)
      • modified residue (204)
      • modified residue (213)
      • modified residue (322)
      • modified residue (372)
    Domains in SCOPe 2.07: d1wz9b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wz9A (A:)
    mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
    envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
    fkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpeset
    kecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvedes
    tglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsed
    tsdfsgmsetkgvalsnvihkvcleitedggdsievpgarilqhkdelnadhpfiyiirh
    nktrniiffgkfcsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz9A (A:)
    mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
    envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
    fkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpeset
    kecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvedes
    tglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsed
    tsdfsgmsetkgvalsnvihkvcleitedgqhkdelnadhpfiyiirhnktrniiffgkf
    csp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wz9B (B:)
    mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
    envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
    fkdkleetkgqinnsikdltdghfeniladnsvndqtkilvvnaayfvgkwmkkfpeset
    kecpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvedes
    tglekiekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsed
    tsdfsgmsetkgvalsnvihkvcleitedggdsievpgarilqhkdelnadhpfiyiirh
    nktrniiffgkfcsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz9B (B:)
    mdalqlansafavdlfkqlcekeplgnvlfspiclstslslaqvgakgdtaneigqvlhf
    envkdvpfgfqtvtsdvnklssfyslklikrlyvdkslnlstefisstkrpyakeletvd
    fkdkleetkgqinnsikdltdghfenilasvndqtkilvvnaayfvgkwmkkfpesetke
    cpfrlnktdtkpvqmmnmeatfcmgnidsinckiielpfqnkhlsmfillpkdvtgleki
    ekqlnseslsqwtnpstmanakvklsipkfkvekmidpkaclenlglkhifsedtsdfsg
    msetkgvalsnvihkvcleitedggdslqhkdelnadhpfiyiirhnktrniiffgkfcs
    p