PDB entry 1wz8

View 1wz8 on RCSB PDB site
Description: Crystal Structure of Probable Enoyl-CoA Dehydratase from Thermus Thermophilus HB8
Class: Lyase
Keywords: Lyase, Crotonase, CoA, Hexamer, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-03-02, released 2005-03-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.224
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wz8a1
  • Chain 'B':
    Compound: enoyl-coa hydratase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wz8b_
  • Chain 'C':
    Compound: enoyl-coa hydratase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wz8c_
  • Chain 'D':
    Compound: enoyl-coa hydratase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wz8d_
  • Chain 'E':
    Compound: enoyl-coa hydratase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wz8e_
  • Chain 'F':
    Compound: enoyl-coa hydratase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wz8f_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wz8A (A:)
    mlaslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravll
    rgeggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagl
    alalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeea
    erlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalef
    lgfsgkeleeglkalkekrppefp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz8A (A:)
    laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
    geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
    lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
    rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
    gfsgkeleeglkalkekrppefp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wz8B (B:)
    mlaslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravll
    rgeggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagl
    alalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeea
    erlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalef
    lgfsgkeleeglkalkekrppefp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz8B (B:)
    laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
    geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
    lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
    rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
    gfsgkeleeglkalkekrppefp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wz8C (C:)
    mlaslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravll
    rgeggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagl
    alalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeea
    erlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalef
    lgfsgkeleeglkalkekrppefp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz8C (C:)
    laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
    geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
    lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
    rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
    gfsgkeleeglkalkekrppefp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wz8D (D:)
    mlaslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravll
    rgeggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagl
    alalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeea
    erlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalef
    lgfsgkeleeglkalkekrppefp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz8D (D:)
    laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
    geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
    lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
    rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
    gfsgkeleeglkalkekrppefp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wz8E (E:)
    mlaslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravll
    rgeggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagl
    alalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeea
    erlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalef
    lgfsgkeleeglkalkekrppefp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz8E (E:)
    laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
    geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
    lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
    rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
    gfsgkeleeglkalkekrppefp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wz8F (F:)
    mlaslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravll
    rgeggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagl
    alalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeea
    erlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalef
    lgfsgkeleeglkalkekrppefp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz8F (F:)
    laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllr
    geggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgagla
    lalaadiavvgkgtrlldghlrlgvaagdhavllwpllvgmakakyhlllnepltgeeae
    rlglvalavedekvyekalevaerlaqgpkealhhtkhalnhwyrsflphfelslalefl
    gfsgkeleeglkalkekrppefp