PDB entry 1wz7

View 1wz7 on RCSB PDB site
Description: Crystal structure of enhancer of rudimentary homologue (ERH)
Class: transcription
Keywords: alpha/beta, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-02-26, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enhancer of rudimentary homolog
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84089 (7-End)
      • cloning artifact (5-6)
      • modified residue (7)
      • modified residue (35)
      • modified residue (41)
      • modified residue (49)
    Domains in SCOPe 2.07: d1wz7a2, d1wz7a3
  • Chain 'B':
    Compound: Enhancer of rudimentary homolog
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84089 (7-End)
      • modified residue (7)
      • modified residue (35)
      • modified residue (41)
      • modified residue (49)
    Domains in SCOPe 2.07: d1wz7b_
  • Chain 'C':
    Compound: Enhancer of rudimentary homolog
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84089 (7-End)
      • modified residue (7)
      • modified residue (35)
      • modified residue (41)
      • modified residue (49)
    Domains in SCOPe 2.07: d1wz7c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wz7A (A:)
    gsegaatmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsityd
    isqlfdfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz7A (A:)
    atmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlf
    dfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wz7B (B:)
    gsegaatmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsityd
    isqlfdfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz7B (B:)
    mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
    iddladlsclvyradtqtyqpynkdwikekiyvllrrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wz7C (C:)
    gsegaatmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsityd
    isqlfdfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz7C (C:)
    mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpsitydisqlfdfidd
    ladlsclvyradtqtyqpynkdwikekiyvllrrq