PDB entry 1wz3

View 1wz3 on RCSB PDB site
Description: The crystal structure of plant ATG12
Class: plant protein
Keywords: ubiquitin-fold, PLANT PROTEIN
Deposited on 2005-02-22, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autophagy 12b
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wz3a1
  • Chain 'B':
    Compound: autophagy 12b
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wz3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wz3A (A:)
    gpmatespnsvqkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyv
    nsafspnpdesvidlynnfgfdgklvvnyacsmawg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz3A (A:)
    qkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyvnsafspnpdes
    vidlynnfgfdgklvvnyacsmaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wz3B (B:)
    gpmatespnsvqkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyv
    nsafspnpdesvidlynnfgfdgklvvnyacsmawg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wz3B (B:)
    qkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyvnsafspnpdes
    vidlynnfgfdgklvvnyacsmaw